PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00019183-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 504aa    MW: 56443.7 Da    PI: 9.7215
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00019183-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR127.31.2e-083553935290
                   FAR1  52 rrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                            + ++++trt+Cka+l+v +e++g w +  + + HnHel+
  SMil_00019183-RA_Salv 355 SYKKQVTRTNCKARLRVIREEEGPWTIFVFFEPHNHELV 393
                            457899*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5087911.21264194IPR002156Ribonuclease H domain
SuperFamilySSF530986.45E-2066194IPR012337Ribonuclease H-like domain
Gene3DG3DSA:3.30.420.106.4E-1468194IPR012337Ribonuclease H-like domain
CDDcd062229.59E-2870190No hitNo description
PfamPF134564.4E-1871191No hitNo description
PfamPF031013.1E-6356393IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003676Molecular Functionnucleic acid binding
GO:0004523Molecular FunctionRNA-DNA hybrid ribonuclease activity
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MISPSVKPRC LSSSKLLTKK RILNLHLGHM ANDWKEYLTL RELGVRSRSA PPPDYIDVHW  60
WPPDLNWMKV NTDGSALGAP GRIFAGGVFR DHRAEVRGCF HVKGGSGFAL EAELLAVIKA  120
IAIAESRGWR KLWLESDSTY VVELLRKKSL EVPWRFLTSW KATIASLNNF ELRISHIYRE  180
GNAAADIMAH SSRQEGWWPH SIEAIETALF GVEPAVRRWR HNTLIEQLLG FFAVVLSNTW  240
GAVAAVLSLF GRTLGGQVVL VPGSLLRRCW FYVADAGLPA CFIEVPQEIE NDFEGKECSL  300
SKELIDSDME SEAIKSIRNQ SEKKLQVGSV YDSLDVIYIL YCYPDNKRLV GRIASYKKQV  360
TRTNCKARLR VIREEEGPWT IFVFFEPHNH ELVSLEQSYT LRSARHMSHG NKSVLDALRH  420
AGIKISSAYK FMEKEAARPP RPSPTPESSP AVAATPTATF ARVPSQQSSC RSAPPPPPVS  480
PVSNRRRSSR ADAALASSSS SFFF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-10FAR1-related sequence 5